GAL, galanin and GMAP prepropeptide, 51083

N. diseases: 226; N. variants: 3
Source: ALL
Disease Score gda Association Type Type Original DB Sentence supporting the association PMID PMID Year
CUI: C0155626
Disease: Acute myocardial infarction
Acute myocardial infarction 		0.010 Biomarker disease BEFREE This study was designed to assess the ability of the full-length galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G1), the natural fragments WTLNSAGYLL-NH2 (G2) and WTLNSAGYLLGPHA (G3), and their modified analogs WTLNAAGYLL (G4) and WTLNSAGYLLGPβAH (G5) to limit acute myocardial infarction in rats in vivo. 29730241 2019
CUI: C0001339
Disease: Acute pancreatitis
Acute pancreatitis 		0.010 Biomarker disease BEFREE Galanin participates in the pathogenesis of acute pancreatitis (AP). 21303427 2011
CUI: C0585051
Disease: Acute sciatica
Acute sciatica 		0.010 Biomarker disease BEFREE Although the sample size did not provide enough power to persuasively search through a larger number of genes, an exploratory survey of 25 other genes provides illustrations of pain-gene interactions on postoperative mood--the mu opioid receptor for short-term effects of acute sciatica on mood, and the galanin-2 receptor for effects of unrelieved post-discectomy pain on mood one year after surgery. 16623937 2006
CUI: C0085281
Disease: Addictive Behavior
Addictive Behavior 		0.020 Biomarker phenotype BEFREE There is a large body of pre-clinical and some clinical data to link the neuropeptide galanin to a range of physiological and pathological functions that include metabolism, depression, and addiction. 25228436 2014
CUI: C0085281
Disease: Addictive Behavior
Addictive Behavior 		0.020 Biomarker phenotype BEFREE Accumulating evidence has suggested galanin as a potential important neuromodulator of addiction. 29949733 2020
CUI: C0338106
Disease: Adenocarcinoma of colon
Adenocarcinoma of colon 		0.010 AlteredExpression disease BEFREE Galanin is up-regulated in colon adenocarcinoma. 18006926 2007
CUI: C4551683
Disease: Adrenal Gland Pheochromocytoma
Adrenal Gland Pheochromocytoma 		0.010 Biomarker disease BEFREE There is also evidence that galanin plays a role in the modulation of HPA-axis response to stress, as well as in the pathogenesis of pituitary adenomas and perhaps of pheochromocytomas. 17334639 2007
CUI: C2347747
Disease: Adult Classical Hodgkin Lymphoma
Adult Classical Hodgkin Lymphoma 		0.020 AlteredExpression disease BEFREE Gal-1 can be secreted from cells by an unknown mechanism, and levels in blood samples were associated with high tumor burden and worse disease state in cHL and CLL patients. 28435287 2017
CUI: C2347747
Disease: Adult Classical Hodgkin Lymphoma
Adult Classical Hodgkin Lymphoma 		0.020 AlteredExpression disease BEFREE Gal1 is selectively expressed by malignant Reed-Sternberg cells in >90% of primary cHLs, and Gal1 expression is concordant with the activated AP1 component, c-Jun. 18519761 2008
CUI: C0278595
Disease: Adult Fibrosarcoma
Adult Fibrosarcoma 		0.010 Biomarker disease BEFREE GAL-TEK bifunctional marking and cell killing activities were tested in vitro after adenoviral vector infection of HT1080 human fibrosarcoma cells. 8527480 1995
CUI: C0278878
Disease: Adult Glioblastoma
Adult Glioblastoma 		0.020 Biomarker disease BEFREE In contrast, in vitro (125)I-labeled GAL receptor autoradiography showed substantial GAL binding in only 6 glioblastoma tissues. 12734662 2003
CUI: C0278878
Disease: Adult Glioblastoma
Adult Glioblastoma 		0.020 AlteredExpression disease BEFREE These results suggest that decreasing Gal-1 expression (e.g. through brain delivery of nonviral infusions of anti-Gal-1 siRNA in patients) can represent an additional therapeutic strategy for glioblastoma. 18431251 2008
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 Biomarker disease PSYGENET Animal studies have implicated GAL in alcohol abuse and anxiety: chronic ethanol intake increases hypothalamic GAL mRNA; high levels of stress increase GAL release in the central amygdala. 16314872 2006
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 GeneticVariation disease BEFREE Reward-related ventral striatum reactivity mediates gender-specific effects of a galanin remote enhancer haplotype on problem drinking. 23489876 2013
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 Biomarker disease PSYGENET Building on these investigations, the present study had two goals: first, to develop a method for inducing voluntary ethanol intake in individual zebrafish, which can be used as a model in future studies to examine how this behavior is affected by various manipulations, and second, to characterize the effects of this ethanol intake on different behaviors and the expression of hypothalamic orexigenic peptides, galanin (GAL) and orexin (OX), which are known in rodents to stimulate consumption of ethanol and alter behaviors associated with alcohol abuse. 25257106 2015
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 AlteredExpression disease BEFREE The neuropeptide galanin is widely expressed in the periphery and the central nervous system and mediates diverse physiological processes and behaviors including alcohol abuse, depression and anxiety. 17083333 2007
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 Biomarker disease PSYGENET The neuropeptide galanin is widely expressed in the periphery and the central nervous system and mediates diverse physiological processes and behaviors including alcohol abuse, depression and anxiety. 17083333 2007
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 Biomarker disease PSYGENET Reward-related ventral striatum reactivity mediates gender-specific effects of a galanin remote enhancer haplotype on problem drinking. 23489876 2013
CUI: C0085762
Disease: Alcohol abuse
Alcohol abuse 		0.330 Biomarker disease BEFREE Animal studies have implicated GAL in alcohol abuse and anxiety: chronic ethanol intake increases hypothalamic GAL mRNA; high levels of stress increase GAL release in the central amygdala. 16314872 2006
CUI: C0001956
Disease: Alcohol Use Disorder
Alcohol Use Disorder 		0.020 Biomarker disease BEFREE These results may give the basis for the development of novel therapeutics strategies using GAL(1-15) analogues for the treatment of alcohol use disorders in humans. 29210146 2019
CUI: C0001956
Disease: Alcohol Use Disorder
Alcohol Use Disorder 		0.020 Biomarker disease BEFREE Given the overlap between galanin expression and reward circuitry in the brain, galanin has been targeted for alcohol use disorder (AUD) and opioid dependency. 28274821 2017
CUI: C0001973
Disease: Alcoholic Intoxication, Chronic
Alcoholic Intoxication, Chronic 		0.330 Biomarker disease PSYGENET The aim of our study was, for the first time, to identify GAL haplotypes and investigate associations with alcoholism and anxiety. 16314872 2006
CUI: C0001973
Disease: Alcoholic Intoxication, Chronic
Alcoholic Intoxication, Chronic 		0.330 Biomarker disease BEFREE Likewise, the combination of the GALR3 and GAL risk diplotypes led to an increased OR for alcoholism (4.6) as compared with the effect of either GAL (2.0) or GALR3 alone (1.6). 17083333 2007
CUI: C0001973
Disease: Alcoholic Intoxication, Chronic
Alcoholic Intoxication, Chronic 		0.330 GeneticVariation disease BEFREE The aim of our study was, for the first time, to identify GAL haplotypes and investigate associations with alcoholism and anxiety. 16314872 2006
CUI: C0001973
Disease: Alcoholic Intoxication, Chronic
Alcoholic Intoxication, Chronic 		0.330 AlteredExpression disease BEFREE Differential activity by polymorphic variants of a remote enhancer that supports galanin expression in the hypothalamus and amygdala: implications for obesity, depression and alcoholism. 21716262 2011