GAL, galanin and GMAP prepropeptide, 51083

N. diseases: 226; N. variants: 3
Source: ALL
Disease Score gda Association Type Type Original DB Sentence supporting the association PMID PMID Year
CUI: C0009319
Disease: Colitis
Colitis
0.010 Biomarker disease BEFREE Moreover, intraperitoneal injection of a galanin antagonist reduced MMCs and inhibited the inflammation of dextran sodium sulfate-induced colitis in mice. 31706262 2020
CUI: C0032749
Disease: Post-kala-azar dermal leishmaniasis
Post-kala-azar dermal leishmaniasis
0.010 Biomarker disease BEFREE We developed Gal enzyme-linked immunosorbent assay to measure specific anti-gal IgG isotype in the sera of 71 Indian patients with PKDL. 31397399 2020
CUI: C0020757
Disease: Ichthyoses
Ichthyoses
0.010 Biomarker disease BEFREE Ichthyoses lacked the epidermal differentiation and tight junction alterations of patients with AD (loricrin, filaggrin, and claudin 1) but showed characteristic alterations in lipid metabolism genes (ELOVL fatty acid elongase 3 and galanin), with parallel reductions in extracellular lipids and corneocyte compaction in all ichthyoses except epidermolytic ichthyosis, suggesting phenotypic variations. 29803800 2019
CUI: C0021053
Disease: Immune System Diseases
Immune System Diseases
0.010 Biomarker group BEFREE Galectin 1(Gal-1), a β-galactoside binding mammalian lectin of 14KDa, is implicated in many signalling pathways, immune responses associated with cancer progression and immune disorders. 30834831 2019
CUI: C0027533
Disease: Neck Neoplasms
Neck Neoplasms
0.010 Biomarker group BEFREE In this issue of the JCI, Nambiar et al. used patient head and neck tumors and a mouse model system to investigate the role of galactose-binding lectin 1 (Gal1) in immunotherapy resistance. 31710312 2019
CUI: C0079153
Disease: Hyperkeratosis, Epidermolytic
Hyperkeratosis, Epidermolytic
0.010 Biomarker disease BEFREE Ichthyoses lacked the epidermal differentiation and tight junction alterations of patients with AD (loricrin, filaggrin, and claudin 1) but showed characteristic alterations in lipid metabolism genes (ELOVL fatty acid elongase 3 and galanin), with parallel reductions in extracellular lipids and corneocyte compaction in all ichthyoses except epidermolytic ichthyosis, suggesting phenotypic variations. 29803800 2019
CUI: C0149721
Disease: Left Ventricular Hypertrophy
Left Ventricular Hypertrophy
0.010 Biomarker disease BEFREE The serum lyso-Gb3 level can be relevant for clinically significant FD, and combined measurement of lyso-Gb3 and α-GAL can provide better screening of FD in unexplained LVH patients. 31308318 2019
CUI: C0155626
Disease: Acute myocardial infarction
Acute myocardial infarction
0.010 Biomarker disease BEFREE This study was designed to assess the ability of the full-length galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G1), the natural fragments WTLNSAGYLL-NH2 (G2) and WTLNSAGYLLGPHA (G3), and their modified analogs WTLNAAGYLL (G4) and WTLNSAGYLLGPβAH (G5) to limit acute myocardial infarction in rats in vivo. 29730241 2019
CUI: C0178417
Disease: Anhedonia
Anhedonia
0.010 GeneticVariation disease BEFREE Role of the galanin N-terminal fragment (1-15) in anhedonia: Involvement of the dopaminergic mesolimbic system. 31081442 2019
CUI: C0233794
Disease: Memory impairment
Memory impairment
0.010 Biomarker phenotype BEFREE Moreover, GAL(1-15) reversed the effects of memory impairment induced by FLX(10 mg/kg) in the Novel Object Recognition task. 31128121 2019
CUI: C0278080
Disease: Physical addiction
Physical addiction
0.010 Biomarker disease BEFREE Preclinical studies have demonstrated that galanin affects physical dependence and rewarding actions associated with morphine. 31135380 2019
CUI: C0542476
Disease: Forgetful
Forgetful
0.010 Biomarker phenotype BEFREE Moreover, GAL(1-15) reversed the effects of memory impairment induced by FLX(10 mg/kg) in the Novel Object Recognition task. 31128121 2019
Secondary malignant neoplasm of lymph node
0.010 AlteredExpression disease BEFREE Furthermore, galanin mRNA and protein expression levels in the preoperative samples from patients with gastric cancer were significantly correlated with lymph node metastasis, tumor node metastasis stage, and size of the gastric cancer. 30616468 2019
Malignant Peripheral Nerve Sheath Tumor
0.010 AlteredExpression disease BEFREE Gal-1 was upregulated in MPNST patients and was highly expressed in MPNST cells. 31127849 2019
CUI: C0752347
Disease: Lewy Body Disease
Lewy Body Disease
0.010 Biomarker disease BEFREE Galanin immunohistochemistry was carried out in the anterior nucleus basalis of Meynert of 27 Parkinson's disease (PD) cases without cognitive impairment (mild cognitive impairment [MCI]), 15 with PD with MCI, 42 with Parkinson's disease dementia (PDD), 12 with Dementia with Lewy bodies (DLB), 19 with AD, 12 mixed AD/DLB and 16 controls. 31454423 2019
Spondylometaphyseal dysplasia with dentinogenesis imperfecta
0.010 GeneticVariation disease BEFREE In spite of reduced abundance, residual GMAP variants maintain partial Golgi integrity, normal global protein secretion, and subcellular distribution of IFT20 in ODCD. 30728324 2019
CUI: C0003175
Disease: Anthrax disease
Anthrax disease
0.010 Biomarker disease BEFREE <i>Bacillus anthracis</i>, the causative agent of anthrax disease, elaborates a secondary cell wall polysaccharide (SCWP) that is essential for bacterial growth and cell division.<i>B. anthracis</i> SCWP is comprised of trisaccharide repeats with the structure, [→4)-β-ManNAc-(1→4)-β-GlcNAc(<i>O</i>3-α-Gal)-(1→6)-α-GlcNAc(<i>O</i>3-α-Gal, <i>O</i>4-β-Gal)-(1→]<sub>6-12</sub> The genes whose products promote the galactosylation of <i>B. anthracis</i> SCWP are not yet known. 29229702 2018
CUI: C0013274
Disease: Patent ductus arteriosus
Patent ductus arteriosus
0.010 Biomarker disease BEFREE Gal-1 sensitivity and specificity values were similar to that of the CA19-9 biomarker (the only FDA-approved blood test biomarker for PDA), and the combination of Gal-1 and CA19-9 significantly improved their individual discriminatory powers. 30250644 2018
CUI: C0018794
Disease: Heart Block
Heart Block
0.010 Biomarker disease BEFREE Here we report that photostimulation of VLPO<sup>GAL</sup> neurons in mice promotes sleep with low frequency stimulation (1-4 Hz), but causes conduction block and waking at frequencies above 8 Hz. 30297727 2018
CUI: C0022578
Disease: Keratoconus
Keratoconus
0.010 AlteredExpression disease BEFREE Ultrastructural analysis of keratocytes showed a marked increase of endogenous Gal-3 levels, but not Gal-1, in KC. 29439091 2018
CUI: C0031090
Disease: Periodontal Diseases
Periodontal Diseases
0.010 Biomarker group BEFREE Both ADM and GAL potentially are new candidates to consider as biomolecules associated with periodontal disease activity. 29676776 2018
CUI: C0086132
Disease: Depressive Symptoms
Depressive Symptoms
0.010 GeneticVariation phenotype BEFREE Implication of galanin gene rs948854 polymorphism in depressive symptoms in adolescents. 28987550 2018
CUI: C0153381
Disease: Malignant neoplasm of mouth
Malignant neoplasm of mouth
0.010 AlteredExpression group BEFREE Recently, GALR1 was also suggested as a tumor suppressor gene that was frequently silenced in head and neck squamous cell carcinoma; moreover, galanin and GALR1 were reported to inhibit human oral cancer cell proliferation. 29462183 2018
CUI: C0220641
Disease: Lip and Oral Cavity Carcinoma
Lip and Oral Cavity Carcinoma
0.010 AlteredExpression disease BEFREE Recently, GALR1 was also suggested as a tumor suppressor gene that was frequently silenced in head and neck squamous cell carcinoma; moreover, galanin and GALR1 were reported to inhibit human oral cancer cell proliferation. 29462183 2018
CUI: C0234119
Disease: Neuromuscular inhibition
Neuromuscular inhibition
0.010 Biomarker disease BEFREE Neurite outgrowth in vitro and erectile response to electrostimulation after BCNI in vivo, immunohistochemical localization of galanin and receptors, and penile muscle relaxation in vitro. 29550465 2018